PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D09G0148
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 299aa    MW: 33783.9 Da    PI: 8.8488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D09G0148genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++q+G+g+W++++   g+ R+ k+c++rw +yl
      Gh_D09G0148 14 KGPWTPEEDIILVSYIQQHGPGNWRAVPTNTGLLRCSKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.45e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++l++++ ++lG++ W++Ia++++  Rt++++k++w+++l
      Gh_D09G0148  67 RGNFTDHEEKLIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-24564IPR009057Homeodomain-like
PROSITE profilePS5129424.425965IPR017930Myb domain
SuperFamilySSF466892.77E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-141363IPR001005SANT/Myb domain
PfamPF002493.3E-161461IPR001005SANT/Myb domain
CDDcd001671.02E-101661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.75466116IPR017930Myb domain
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.9E-1467112IPR001005SANT/Myb domain
CDDcd001671.93E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGRPPCCDKA GLKKGPWTPE EDIILVSYIQ QHGPGNWRAV PTNTGLLRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKLIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKIN  120
GSESYSREGF SSEKHQISRG QWERKLQTDI QMAKQALSDA LSPDKSSGLA SKPRGYASST  180
ENIAKLLKKW MRNPPKPASS DNMGGIGTPW KENKSSNSIE MSEVFESLDV FESFDSSNSD  240
FSQSLSPDQA RLFQDESKQD VNELGQLTLL EKWLFDDGAN QGKDDQLSDI KLDGNAIFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012483622.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-113MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D2SQT60.0A0A0D2SQT6_G
STRINGVIT_14s0108g00830.t011e-129(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM58422348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-108myb domain protein 30